Skip to content

My Account
Our Shop
Contact Us

Top Bar

FREE SHIPPING on orders above $59Follow Us On Social:

Facebook page opens in new window Instagram page opens in new window

Tubby K9 Tasty Treats

About Us
Shop Now
Store Locator
Our Blog
Contact Us

$0.000

View Cart Checkout

No products in the cart.

Subtotal: $0.00

View Cart Checkout

About Us
Shop Now
Store Locator
Our Blog
Contact Us

Contact Us

OUR LOCATION

Niagara Region, Canada

DROP US A LINE

info@tubbyk9tastytreats.com

Name * E-mail * Telephone

Message *

FACEBOOK

@TubbyK9 Tasty Treats

INSTAGRAM

@TubbyK9

☀️ • • • 📸 @wagnwalknorthyork #tubb

☀️

•
•
•
📸 @wagnwalknorthyork
#tubbyk9 #tubbyk9tastytreats #naturaldogtreats #dog #natural #healthy #dogtreats #gta #niagara #pet #animallovers #doglovers #ontario #canada #canadiandogtreats

🌟Exciting News Spotlight!🌟 We’re thrilled

🌟Exciting News Spotlight!🌟

We’re thrilled to share some fantastic news about Tubby K9 Tasty Treats being featured in Onside Media 📰🗞️✨

It’s an incredible honor to see our company highlight in the media, and we couldn’t be more proud!

Read the full article 👉🏼: https://theonside.com/featured/tubby-k9-tasty-treats-where-whiskers-meet-wagging-tails/

•
•
•

#tubbyk9tastytreats #petlovers #petlover #dog #dogwellness #dogtreats #news #about #niagara #businessowners #petindustry #pets #welovepets #welovewhatwedo

Excited to announce that Tubby K9 is officially pa

Excited to announce that Tubby K9 is officially partnered with Bone and Biscuit, to bring the goodness of natural Canadian treats, across Canada 🇨🇦

Happy to also announce our first store in Western Canada! @boneandbiscuitstonecreek 🐶

•
•
•
#tubbyk9tastytreats #tubbyk9 #dogtreats #naturaltreats #boneandbiscuit #boneandbiscuitstonecreek #westerncanada #canadianmade #dog #treats #youkeepthemhappywekeepthemhealthy #healthydog #puppies #dogsoffortmcmurray #dogsofalberta

Our recap of 2023🎉 We upgraded our packaging a

Our recap of 2023🎉

We upgraded our packaging and made many memories from multiple events. We met countless passionate pet parents and their amazing fur babies🐶

We can’t wait to see what’s in store for 2024!
Thank you all for your continued support ❤️

Happy New Year!
•
•
•

#tubbyk9tastytreats #tubbyk9 #healthydogtreats #healthydogsarehappydogs #dogs #dogsofinstagram #dogtreats #natural #newyear #2023 #2024 #newyear2023 #2023wrapped #niagarabusiness #dogsofontario #dogsofcanada #spoilyourdog #treats

Merry Christmas from the Tubby K9 family ❤️

•
•
•
#dogchristmas #dogchristmasgifts #healthydog #naturaltreats #holiday #christmas #dog #christmastime #tubbyk9tastytreats #tubbyk9 #spoilyourpet

We are excited to announce that Tubby K9 has partn

We are excited to announce that Tubby K9 has partnered with Global Pet Foods, the largest Canadian-owned pet specialty retailer to deliver premium quality single ingredient pet treats across Canada.

Tubby K9 Tasty Treats are:
- 100% Natural
- Hi-Protein
- Free from Additives and Preservatives
- Human Grade Ingredients
- Gluten Free
- Made in Niagara 🇨🇦

•
•
•
#tubbyk9tastytreats #tubbyk9 #globalpetfoods #canada #premiumdogtreats #dogsofcanada #dogtreats #healthydog #singleingredient #additivefree #preservativefree #doglife🐾 #happydog #dogmomlife #dogdad #dogparentslife #dog #dogloversofinstagram #dogsofcanada #ontario #locallymade #canadianmade #partner

Load More Follow on Instagram

Working from home with your dog

Jealousy in Dogs

How to get rid of dog smell

Is your dog happy?

Can Dogs Have Fish Oil?

How Do Dogs Process Words?

© 2024 TubbyK9 Tasty Treats - All rights reserved | Website designed by KMK Web Design - Niagara website designers

Shop
My Account
Returns & Refunds
Terms & Conditions
Contact Us

Footer Menu